PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462877636
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 1561aa    MW: 170047 Da    PI: 6.3146
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462877636genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox33.95.4e-116837241253
                HHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
   Homeobox  12 leeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                 + L+++Fe+++yps++++e LA++lgLt +qV  WF   R 
  462877636 683 KQKLKNHFERDPYPSRATKENLAQELGLTFTQVDKWFATTRH 724
                689**********************************87775 PP

2Homeobox30.94.7e-10890936753
                --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
   Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                f +  ++ L+++Fek++yps++++e LA+ lgLt  qV  WF   R 
  462877636 890 FGPIVTQKLKDHFEKDPYPSRATKENLAQVLGLTFIQVDKWFATTRH 936
                55667899**********************************87775 PP

3Homeobox31.43.3e-10115511971052
                 HHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
   Homeobox   10 eqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52  
                 +q   L+++Fek++yps+++ + LA++lgLt  qV+ WF   R
  462877636 1155 QQGLKLKAHFEKDPYPSRSTVQNLAQELGLTFIQVRRWFSSTR 1197
                 67789**********************************8665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.6E-12672733IPR001356Homeobox domain
SuperFamilySSF466891.15E-11674729IPR009057Homeodomain-like
CDDcd000861.28E-12676727No hitNo description
PfamPF000462.2E-8683724IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-12684736IPR009057Homeodomain-like
PROSITE profilePS5007112.876686729IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.1E-11876932IPR009057Homeodomain-like
PROSITE profilePS5007113.167881941IPR001356Homeobox domain
SMARTSM003899.9E-12883945IPR001356Homeobox domain
SuperFamilySSF466891.88E-11883940IPR009057Homeodomain-like
CDDcd000864.51E-11884939No hitNo description
PfamPF000461.7E-7890936IPR001356Homeobox domain
SMARTSM003895.6E-811411207IPR001356Homeobox domain
PROSITE profilePS5007111.90411431203IPR001356Homeobox domain
CDDcd000861.11E-911541197No hitNo description
PfamPF000461.0E-711551197IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.2E-1011551198IPR009057Homeodomain-like
SuperFamilySSF466892.14E-911551198IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1561 aa     Download sequence    Send to blast
MGKKGSEVSP SKRYPLRSTH SSGRVLRSAS NKNNTACSKT LNDSATAQPA LRKRKSGISS  60
GSTNNSVRVL RSASKNKDDV CNESLNDSIA GEPAANKRTG IGPSKAASPI SSVRVLRSAA  120
KNKDDACNES LNDSIAGEPA TNKKTGIGPS KATSPINNVR VLRSASKIED EAPLNGSTAG  180
EQAAHERKFV TPLKVGHPNN SVRVLRSASK NKNDVCNESL NDSTVAQPSA KKRKTGSPLK  240
VGSPPSSARV LRSNSKGKNE TFDEPVNDSP AAQPATRKRK SDTPPNEGSQ KLGVRVLRSA  300
SKKENYACFE PQNVSTSGQP AVRKRQGVRS SQERSPKKAY LKVCQRVRSI LNRMNYEQSL  360
IQAYASEGWK GQSLEKIRPE KELERAKAEI LRCKIKIREA FQNMDSLLSE GKLEESLFDS  420
AGEIFSEDSL QGMKDGFVLH KVFPEAASPA NGSKQLDASD PPVGEENDYN PALAEAHMGN  480
EVRSDAGIDG KGTVDDLGLP SEDSEDDDFD PAGPDSSEDE KNESHSEESD FTSDSDDFCT  540
EIAKSSGQGE VSSSPLSNVN EESCNDAFME MDLDQDVVLP VSGRRQVERL DYKKLYDEAY  600
GEESSSYSDD EEWSGKENLE DNETDGSVRP GKRRTRRASA GHSVNEHTPQ DERHYGSVNE  660
HNADVLRSNG SNSTARRFGP IIKQKLKNHF ERDPYPSRAT KENLAQELGL TFTQVDKWFA  720
TTRHSSRVAA AKKGKHTGSH TTMDNDGTTV DSTQVREPND EVLVKLTAEG NGLVYEGELM  780
QNNLDEVNKE DMLLSRAETE TEAHGKESSD QSDDDKDWSG TSTSQTGLED IEIDSLAASN  840
RAKQLSRRAP VRQQNHEHTP LSERRHGSVE QHTETPCSDR SSGKARKYHF GPIVTQKLKD  900
HFEKDPYPSR ATKENLAQVL GLTFIQVDKW FATTRHSSRV AAAKKGKRTG SHTTIDNGGT  960
TVDGAQVREP NDEVLVKLTA EGNGLVYEGE LMQNNLDEVN KEDMLLSRAE TETEAHGKES  1020
SDQSDDDKDW SGTSTSQTGL EDIEIDSLAA SNRAKQLSRR APVRQQNHEH TPLSERIHGY  1080
VNERQTETPC SDGSSGKARK YHFGPIVTQG SSLRDNTAPA HSTGAPPPCT ANTVTACTTL  1140
SRMTRRSELE LGASQQGLKL KAHFEKDPYP SRSTVQNLAQ ELGLTFIQVR RWFSSTRHYS  1200
SVSSAKKGKD PGNQTTEKND GTTVDSIQGM ESSNLMENPT ADRNDMASEK LMLQINLNEG  1260
NNDDIILNQY PSCEETVVTT PTAISREVGP PGYGPGENQG NGALWNTAFE QGLNTTPSTV  1320
SIEVGPPGYG LGENQGYGAS WNTISEQRIL TTPTATTMSM SHEVGPPGYG PGENQASAAS  1380
WNTSFKQQEI MTPNTSSREA GPPGYGSREG QVNGASWNTS SEQRVGTAPS TTISRQVGLP  1440
GYGPGENQVS GASWNTSTEQ RVVMTPSTIP REVGPPGYWP GEIQGNSASW NKSCEKSVLM  1500
TPSTTSNKGS HLGYWPRENQ GNGASRNVES PKGRSSEKLE LDDEARKKAI ARELRRMKKF  1560
R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1275280TRKRKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105549.10.0uncharacterized protein LOC542536
TrEMBLK7VCP70.0K7VCP7_MAIZE; Putative homeodomain-like transcription factor superfamily protein
STRINGGRMZM2G351018_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43933768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-25Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain